Results 1 to 3 of 3

Thread: cjc-1295 petide sequence verification

  1. #1

    cjc-1295 petide sequence verification

    can any bros help

    i have found a source regarding cjc-1295 quite cheap - a manufacturer but im concerned over the peptide sequence?
    i saw a post on here regarding the sequence but it is not the same as what my company sent me- they say its definately cjc-1295

    this is what they sent

    peptide name): CJC-1295
    peptide sequence
    YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2

    molecular weight: 3369
    Purity: 95.07%
    they sent other stuff as well (like the charts they use to verify chemicals )

    it seems that this manufacturer has written the sequence in shorthand? can anyone confirm its the same sewuence as the one below (im assuming that CARLITO (from another board) who posted the correct seqeuence originally (see below)


    cjc-1295
    1 H-Tyr-(D)Ala-Asp-Ala-Ile
    - -Phe-Thr-Gln-Ser-Tyr-Arg-Lys
    - -Val-Leu-Ala-Gln-Leu-Ser-Ala
    - -Arg-Lys-Leu-Leu-Gln-Asp-Ile
    - -Leu-Ser-Arg-NH2

    CJC-1295 is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively.

    so is the above sequence correct? and also is the one below (what my source sent me) exactly the same ?


    YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2



    can experts help cheers?

    p.s im not a newbie here im brian 123 but lost my password and email addy!

  2. #2
    Join Date
    Apr 2007
    Location
    SoCal
    Posts
    339
    just for BUMP's sake... I'll chime in...

    I have F'n clue what you're talking about

  3. #3
    Join Date
    Apr 2007
    Location
    USA
    Posts
    1,353
    bump

Thread Information

Users Browsing this Thread

There are currently 1 users browsing this thread. (0 members and 1 guests)

Posting Permissions

  • You may not post new threads
  • You may not post replies
  • You may not post attachments
  • You may not edit your posts
  •