can any bros help
i have found a source regarding cjc-1295 quite cheap - a manufacturer but im concerned over the peptide sequence?
i saw a post on here regarding the sequence but it is not the same as what my company sent me- they say its definately cjc-1295
this is what they sent
peptide name）: CJC-1295
peptide sequence
YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2
molecular weight: 3369
Purity: 95.07%
they sent other stuff as well (like the charts they use to verify chemicals )
it seems that this manufacturer has written the sequence in shorthand? can anyone confirm its the same sewuence as the one below (im assuming that CARLITO (from another board) who posted the correct seqeuence originally (see below)
cjc-1295
1 H-Tyr-(D)Ala-Asp-Ala-Ile
- -Phe-Thr-Gln-Ser-Tyr-Arg-Lys
- -Val-Leu-Ala-Gln-Leu-Ser-Ala
- -Arg-Lys-Leu-Leu-Gln-Asp-Ile
- -Leu-Ser-Arg-NH2
CJC-1295 is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively.
so is the above sequence correct? and also is the one below (what my source sent me) exactly the same ?
YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2
can experts help cheers?
p.s im not a newbie here im brian 123 but lost my password and email addy!
Reply With Quote
